dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|414079581|ref|YP_007001005.1| (Anabaena sp. 90)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 50S ribosomal protein L33 [Anabaena sp. 90]
Sequence length 64
Sequence
MAKSKGARIIVTLECTECRTNPDKRSPGVSRYTSTKNRRNTTNRLELKKFCTHCNKHTVH
KEIK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]