dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Traes_3AL_C97D62D50.1 (Triticum aestivum 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_3AL_scaff_4452642:5892:9939:-1 gene:Traes_3AL_C97D62D50 transcript:Traes_3AL_C97D62D50.1 description:""
Sequence length 567
Sequence
MSDPCECCQIKLKFLRQINGNFMHSLVIPEWFVNQFGGKIWRTVKLESPNGNVYDVGVTE
NMNRTILKSGWASFVDANKIEENYSLMFRYLGNTRFKVTIFDSSGKQKASCCARMGTAAS
DVRNPSTFDVDNSSSSCGGTTQSSPSERSDSDGSQKESSYGYKKSAKKAAISDSSEELSA
EDSLSRDNLVESYDVQVHLNDYVLSGKCDLTVAQEAKIQALVEKIRSEIPVLVVQMKKTS
ANFGNLIIRKDYALKYFPCEATNIILQLPRKNKEWKCRFNPGRRNLYLGYFVHDNCVQEG
DICLFQPIAKVKEGRFTIIVHLLHKESVRRSPGGTAGMTHTATDRRTSAKTSLTARVKKT
SLTAHVKEEPATDGEHKTTDRRTGAKTTLTSRVKEEPATDGEDTSSLRPEEDGDNSEGAS
ETPFVLPERASITPAQEQKVREKVEAFESTVPVYVAILNKCNVARKSGMIITMGKQYALR
YLQKQYFTGHRGKKNVISLVLQREGKSRMWDTELRRGIDRMMICKGWVAFARGNHLQVGD
LCLFKLMESEEPLKMMVYIIRREKCLD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]