dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

EKC41374 (Crassostrea gigas 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel supercontig:GCA_000297895.1:scaffold121:380028:387350:-1 gene:CGI_10025646 transcript:EKC41374 description:"Transcription initiation factor TFIID subunit 4 "
Sequence length 546
Sequence
MATSAAFRPQQISIAPRPGTTQNTIALPPGVQIPPGAQLVRNEQGQLVFVIQQPAATSAA
TGHRMFVRQPANSPGPVRPHQIVTIQPPGMNRQVNLSTAATTATPVSTLIRTTAPVGAPH
TTPSGAPQQPPDNVKKCKNFLSTLMKLAQSQPQQTVKNVRELIQGLIDGKVEPQTFTEKL
QIELRSSPQPYLVPFLKKSLPALRQALIANTMTIEDVKAPPLEVLQPVVSIGNLVHTQLH
PSTHHAAVRGQHVIGIPKTVTAVTGKAPHHTGLPAQGRTSTPHKEKTKYDSLKDDDDIND
VATMGGVNLSEESKNILASNADFIGTQIRSCKDEAFLYHGPLLARITAIAKKHGIDDISS
DVANLVSHATQERLRDLLEKLDTIAEHRIEIYKMNERFEASTDAKSQLKFLEELDKMEKK
RHDDQEWEKIMKAAKSRSKNEDPEQQKIKQKAKELQQAEIERMRQEEANQTALAAIGPRK
KRKTDFGEISSSGSGGLSVSNGGSSSSKTTSTRQRIKRVTLRDVLFLMEQERSLGKSTLL
YKTFLK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]