dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|347549435|ref|YP_004855763.1| (Listeria ivanovii subsp. ivanovii PAM 55)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment putative penicillin-binding protein 2B [Listeria ivanovii subsp. ivanovii PAM 55]
Sequence length 752
Sequence
MKRRIGNMRRGALVLFIFFTILFLLVSGRFLYLQIVGEANGVPLAAKASKQHLKSSVLEA
KRGSILDRKGEVLAEDTASYTVAAVVSDKLPKTTKNPMRVVDEEKTAQVLAKYIPMDESD
ILDKLNEKGKYQVEFGAAGKNISTETKAKIEKENLPGIEFTRQSERFYPNGTFATQLIGF
AQQEEEKNKSVLEGKMGIESRFNEALTGTNGKIDYSTDRMGYILPNSKNKVTKAKDGKDI
TLTLDKKIQTFLEDTMTTVDAKYNPKNMMAVVADPKTGEILAISQRPSFNPADRSTITGN
SSSIWQDLPVEYAYEPGSVMKIISLASAIDTNVYNPNEYYQSGSYKVGDIAIHDHNNGVG
WGSIPYREGVERSSNVAFAKLLNKMGTDTFHTYLDKFGFGKKTGIDLPNETSGKILYNYP
IEKVTTVFGQGTTVSMMQMIQAASAIASDGTMKQPYVVSKVTDPNTGKETETKTTTAGKP
ISAATAKKTRDELKNVISGEHGTGKLYAIPGYDVAGKTGTSQIPNPKTGKYMTGANNYIF
SFLGMAPADDPELVIYVTMQQPQLSGSETGGEAVSEVFNPVMKNSLQYMNIKPGDVEKLA
SEKVPVVTEKTVTDAKKTVTAKGLEAVVVGNGKKIVQQLPQANSDLMQGQKVILMTDGDM
TAPDMVTWSKDDALKVSEITGIPFEFSGSGYVKSQSVSAGSVINSDTKMKITLAPPEQIS
QFNQNHDQDQAEKNKKATDIQENAGIGDLLNQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]