dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|407643111|ref|YP_006806870.1| (Nocardia brasiliensis ATCC 700358)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transporter [Nocardia brasiliensis ATCC 700358]
Sequence length 453
Sequence
MNSLTLILLAVLLVPVGGVFAGVDSALNTISPARVDDMVRADRPGAVRLSRIVADRARYV
NLMVLLRILCEIGATVLLAAGLLAVWADDWALLVTAIVMVLVSYVVIGVGPRTLGRQHAY
SIALASALPLQFIGALLGPLSRLLILLGNAITPGKGFRNGPFASEIELREVVEMASERGV
VADDERRMIQSVFELGDTAARAVMVPRTEMVWIEADKTAAQAMSLAVRSGHSRIPVIGEN
VDDILGVVYLKDLVPYAERGRKVLVREVMRPAVFMPDSKPLDSLLDEMQRRRNHMALLVD
EYGGIAGLVTIEDVLEEIVGEIADEYDTDETPPIEDLGDGRYRVSARLPVEDLGELYGLD
IEDEDVDTVGGLLAHELGRVPLPGSKVEVHGLVLRGEGGADTRGRVRVHTVVVRKATDKS
QNADGDEKSNGKRKGNGSDRDNPAGRHEDGDSE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]