dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|538262825|gb|AGU94026.1| (Vibrio campbellii ATCC BAA-1116)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phosphoribosylaminoimidazole-succinocarboxamide synthase
Sequence length 367
Sequence
MSLANQVLAVNDDLPIRTHKPVHSGKVRSVYWLTEEDSARLIKEKGYDVAPDAPLAIMVI
SDRISAFDCIWHGEGGLKGVPGKGAALNAISNHWFKLFKDNGLADSHILDIPHPFVWIVQ
KAKPVKIEAICRKYITGSMWRAYANGEREFCGIELPEGLEKDKALPELLMTPSTKGILKG
IPGVPEADDVNITRQNIVDNFEAFNFSNAKDIAQYEKLLKEGFNVISSALEAIDQTFVDT
KFEFGYVHDAAGNEKLIYMDEVGTPDSSRIWDTKEYQAGNIVENSKEGFRQFLLSHFPDP
DILLNKERMPEREALARDNELPVESLMDISRTYIGIAEKITGQPIKLSNDPKAEIIEILS
KEYGLID

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]