dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|538263016|gb|AGU94217.1| (Vibrio campbellii ATCC BAA-1116)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment membrane protein
Sequence length 261
Sequence
MEMIEPTMLLVLALVAFVAGFIDAVAGGGGMLTVPALLSLGLPPHIALGTNKLAASFASS
TAAFTYYRKRLFKPQCWGRAFLATLIGATLGTLFVDAISTEWLEKVLPLIILAAAMYTVF
HKTPQSTHQSPTPEPCPMLNKKQYAQGFTIGFYDGLAGPGTGAFWTVSSMALYRLNILLA
SGLAKAMNFTSNFTSLITFAVLGHINWVLGLTMGVCLMAGAFIGAHSAIRFGSKFIRPVF
VTVVSVLAIKLAYDAWFVGLA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]