dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|387815872|ref|YP_005431365.1| (Marinobacter hydrocarbonoclasticus ATCC 49840)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cysteine sulfinic acid decarboxylase (Csad) [Marinobacter hydrocarbonoclasticus ATCC 49840]
Sequence length 558
Sequence
MTGKKKSAQASLEAMYRVFTVPEAPESTLSRIDQDISRNLAGFLQEHIVAIERDLSEVEK
DFSDYVIPEKPVFVSEQTQFLLDKLVANSVHTASPAFIGHMTSALPYFMLPLSKIMIALN
QNLVKTETSKAFTPMERQVLGQIHRLVYQEDGSFYRKWMHDPRHALGAMCSGGTVANLTA
LWVARNRAFPAEGSFRGLHEEGLFRALKYYGHEGAAIVVSKRGHYSLRKAADVLGLGRDA
LVPVETDEFNRIQTDALRDKCLELQKQKIKIMAICGVAGTTETGNVDPLDAMADIAREFG
AHFHVDAAWGGPTLFSRTHKHLLRGIEKADSVTFDAHKQLYVPMGAGLVVFKDPGLASAV
EHHAQYIIRKGSRDLGSTTLEGSRPGMAMLIHSGLKILAREGYEILIDQGIDKAKTFANM
IDEQPDFELVTRPELNILTYRYCPEDVRQALAMADELQAEKMNTCLNRITKFIQKTQRER
GKAFVSRTRLEPARYYHFPCIVFRVVLANPLTTPDILEDILREQRELSKEDGIADEIGIL
HQMAAAVLKQNQKEARQA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]