dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|379727978|ref|YP_005320163.1| (Melissococcus plutonius DAT561)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment L-aspartate-beta-decarboxylase [Melissococcus plutonius DAT561]
Sequence length 546
Sequence
MSENKEFAESLSPFELSLFLEKKIHEKNQNIENWLNAGRGNPNWTAPTPREAFFLLGQFA
VQETLIDENRATAGMVSESETRAERFLAFLTQHSGKGREFLINIWNDGNDYLGMEKTEWL
DQILDAIIGDNYPNPANCLSACEPAIKAYLNQELFSDQAKPFDIFAVEGGTAGICYLFDT
LINNFLLKKGDKIALMLPTFAPYLELTELAHYDFEVVKITAEQTQLDEKNSCQFSEEEID
KLKDTSIKAVFVVNPSNPTANAICYSTMKQIKKIVLNDNPKLMIITDDVYGTFVDDFHSL
FAELPFNTACIYSYSKYFGATGWRIGTIAVSHENLFDQLLHQQSSDQKKQLQKRYCSLKS
NVEELTFIDRLVADSRDIALNHTAGLSSAQQVMMTLFSLYALLDKGKNYKQEVMNICRSR
EKLLYQTLDLEEPLEELNTSYYCEINFKEWLEKRYGREFSEYFKNDWTVTKFLTSLAEEE
QLMLLRTNDFGSDDWSIRISLANLSTSQYKEVGKRIIHLADTIQKKWLENKDKSAKVITV
KKNLAE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]