dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|340623925|ref|YP_004742378.1| (Methanococcus maripaludis X1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phosphoribosylaminoimidazole-succinocarboxamide synthase [Methanococcus maripaludis X1]
Sequence length 246
Sequence
MSEYDISKILANEPIYAGKAKSIYKIEENEKEVLVEFRDDITAGNGAKHDVKSGKGYLNT
LISTELFNVLEKNNVPTHLIEYIEPNIMIAKNVKIIPLEVIVRNIAAGSLCKKYPFEQGQ
VLKTAVTQYDYKNDDYGDPMLNNEIAIELGLATEEELVEIKKLALKVNDVLKGFFDEKGI
MLVDFKIEVGKTVDGQIVVADEISPDTMRLWDKETKDVLDKDVFRKDLGDVLEKYKIVAE
RIGCLK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]