dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|340624483|ref|YP_004742936.1| (Methanococcus maripaludis X1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment CutA1 divalent ion tolerance protein [Methanococcus maripaludis X1]
Sequence length 104
Sequence
MEKPTLVYTTFPNFETAKSIVGYLLEKKMIACANLREHEAHYFNDGDLSINTEIGAFLKT
TENRWISLKDMINEIHPLETPAILKINIDDSNDEFKNWILNIIK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]