dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|397781024|ref|YP_006545497.1| (Methanoculleus bourgensis MS2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein BN140_1858 [Methanoculleus bourgensis MS2]
Sequence length 92
Sequence
MREEDLDWAVYHQIPENGGVTTGDLVAATGFEPSAVTASLERLERYLLIRRSGETVRLLS
VQESLVECRCRYTVDLPFVIENGVIKAKRRDE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]