dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|336121379|ref|YP_004576154.1| (Methanothermococcus okinawensis IH1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Homoserine kinase [Methanothermococcus okinawensis IH1]
Sequence length 307
Sequence
MKMVKVCSPGTSANLGPGYDVFGLALYEPYDTITVMKTDDSNDNDNKITITMEGEKCEEI
PTDVDKNTAGVVAKKMMEDFDISDNIHIHIEKGIKPGSGLGSSSASCAGIAVAMNELFDL
KLSKLELTQYASLGEAVAAGAPHADNVAPAIFGGFTMVVGYEPLEILHTPVEFEVLVALP
NIQIPTKEARELVPKNIPIKDMVNNVGKACGMVYALHTNNIELFGKYMMHDAVVEPCRAP
LIEGYSEVKEKVKDLVYGITISGSGPAIISLPKKEHILEVKKIFKETWNCPIYYTKVGPG
AYVLESK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]