dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|479151189|ref|YP_007781365.1| (Ruminococcus bromii)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment LSU ribosomal protein L9P [Ruminococcus bromii L2-63]
Sequence length 148
Sequence
MKVILMQDVKSLGKKGELVEASDGYARNFLLPRKLAKEANAQAMNEYKNAENSKNYKIAT
QKAQAEHDKKTLEGKTFKMTAKAGQGGRLFGSVTSKQVAEEIKKQYNIDVDKRKVVLDCD
IKEFGTYHAEVKLFTGVSAKIDVQVSEA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]