dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|557222673|ref|YP_008762888.1| (Pseudomonas sp. VLB120)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment propionyl-CoA carboxylase [Pseudomonas sp. VLB120]
Sequence length 535
Sequence
MAILHTQINPRSAEFASNSAAMLEQVQALRSLLAQVSQGGGPKAQERHTSRGKLLPRERI
DRLLDTGSPFLEIGQLAAHEVYGEDVPAAGLIAGIGRVEGVECMIVANDATVKGGSYYPL
TVKKHLRAQTIALQNRLPCIYLVDSGGANLPRQDEVFPDREHFGRIFFNQANMSALGIAQ
IAVVMGSCTAGGAYVPAMADEAIMVRQQATIFLAGPPLVRAATGEVVSAEDLGGADVHCR
TSGVADHYADNDEHALALARRSVANLNWHKLGKLQRQTPIAPLYSAEELYGVVPADAKQP
FDVREVIARLVDGSVFDEFKALFGTTLVCGFAHLHGYPVAILANNGILFAEAAQKGAHFI
ELACQRGIPLLFLQNITGFMVGKKYEEGGIAKHGAKLVTAVACAQVPKFTVIIGGSFGAG
NYGMCGRAYDPRFLWMWPNARIGVMGAEQAAGVLAQVKREQSERSGQPFSAEDEARLKQP
ILDQYEHQGHPYYSSARLWDDGVIDPAQTRDVLGLALSASLNAPIEQSRFGIFRM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]