dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|557223219|ref|YP_008763434.1| (Pseudomonas sp. VLB120)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment enoyl-CoA hydratase-isomerase [Pseudomonas sp. VLB120]
Sequence length 257
Sequence
MPRYLDVQAPESGVRLITLQRPEALNALCTELLEQLAAELEDAERDEHTQVVVLTGSRKA
FAAGADIREMAERDLVGILNDPRVAHWQRIATFAKPLIAAVNGYALGGGCELVMCSDIVI
AGEDARFGQPEINLGIIPGAGGTQRLLRAVGKPLAMQMVLTGEAIGARHALQAGLVSEIT
QPELTVERALQVARSIAAKAPLAVRLAKEALLKAGDIDLASGLRFERHAFTLLAGTADRD
EGVRAFMEKRPARFTGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]