dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|336119409|ref|YP_004574186.1| (Microlunatus phosphovorus NM-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein MLP_37690 [Microlunatus phosphovorus NM-1]
Sequence length 313
Sequence
MAGQDALEVLAKAGRGWRLNHAAMLLAEGGVPVFPCAPGGKTPLIRDGQGFLDATTDKRQ
VRAWWRLHPWANIGIPTGAASGLVVVDVDVHRPVDGLRAFVRAGDAGLVKGWGLLVSTPT
GGQHAYFPAIPGVEQRSWQAGSVGIDFRGDGGYIIAPPSIRIIDGIASRYKVGGGEYLGQ
PLPVDSERLRDFLDPRPAPTHHAVPARDSDGADADRLAAWLSRQATDRNLKLFWASCRLA
EGGVPVTDAVDAMVTAAQSDFGEREITRTVHSAYRSVGAGARQRAPADAPGASADGFARC
DRAAPESASRGLS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]