dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|172044158|gb|A4IIF2| (Xenopus (Silurana) tropicalis v7.1 (annotation v7.2))

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment RecName: Full=Solute carrier family 26 member 9; AltName: Full=Anion transporter/exchanger protein 9
Sequence length 794
Sequence
MNKVRPRYIIDRPAYSVELFNEEYEKKIRSYPIGGKARKLFSCSTSKIKNFIFRLFPILS
WLPKYNIKGNLLNDALGGISAGTIQIPQGMAFALLANLPPVNGLYSSFFPLVVYFFMGGI
PQMVPGTFAVISIIVGNVCLKLAPESHFQNVTSNGTITNIEAMNTARMHISATLACLTAI
IQIALSFVQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGVSIPPYSGVLAIIYTFI
DICKELPKTNVASLIFALISTVLLIIVKELNMKFMHKIRFPIPMEIIIVIVATAVSGSFK
LPERYHMNVVGHIPLGFPSPTVPNVTQWDEMVGTAFSLAIVGYVINLAMGRTLGAKHGFD
VDANQEMLALGSGNFFGSFFFIHVICCALSVTLAVDGAGGKSQIASFFVMMSVMVTILAL
GTYLNPLPKSVLGALIAVNLKNSLKQLSDPFYLWKKSKLDCLVWLVSFFSTFILGLPYGL
AVGVAFSILVVIFNTQFRNGSSLNQVTATDIYVNPKVYSKVQPIDGIKIVTYCSPLYFAN
SEIFRQKVIKKTGLDPGKVYLSKKKYLKQQEQELKKKEQKKKRGSLFMKNKTLSLQELQE
DFDGVSPTDSNNNSTVNGTASAISYISSNTLTSGSQTTENVQNGFSTPAQTQDPIIAAPP
IVNFHTVIIDMSGVCFVDLMGIKALGKLCTSFQRIGVNVYLADVQAQVYDDIENGGMFAE
GSLDRKHLFITVHDAVLYAEANNTGIVNTDSKKKGAGDTEIYITDTQDEISEDYPNLEEA
MFGSMFQTEIQTAL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]