dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|392429693|ref|YP_006470738.1| (Mycoplasma bovis HB0801)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pyruvate dehydrogenase E1 component subunit alpha [Mycoplasma bovis HB0801]
Sequence length 363
Sequence
MNYKYVKPGHATSDPNETVRFLDVDGKLIQEYKPSEETKKKLVEMYKNMIRSRQWDLYSL
TLQKTGRLGTFAPALGEEAALTGIGYNLNKEDWFIPHYRVLPTQLARGISMDKIYSYWQG
SEIGSAFAGTNTLPLHVVIGSQVPIAAGVAQALKFQGKKALAMVTIGNGGTNEGEFHEGL
NMASVRKWPLVTVVMNNQWAISVPEHNSYIVKTLSQRAKSYDMPGVRVDGNDLIAVNEVM
QEVYDFVREGNGPVLVEMVTWRQGQHTTSDNPRVYRSRELEVEKEKWEPFHRIEAYLLSE
KLITEEDIKVWSEAAYEEAKAAYALSKELCEATTFDHIYDYTYEKLPADLVRQKETNRKL
FGK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]