dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Lus10018216|PACid:23179383 (Linum usitatissimum v200)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 127
Sequence
MASLPISFATTQVFAATAAKGSGGSKEEKGPWDWIVGNLIKEDQFYETDPILNKTEEKSG
GGGERCRRGNERTGGTDCRQXXXSVELLPAGKAPLSQFPRRRRAALVASSPRIDDESVIK
KNHTQIY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]