dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|283778073|ref|YP_003368828.1| (Pirellula staleyi DSM 6068)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Psta_0273 [Pirellula staleyi DSM 6068]
Sequence length 153
Sequence
MTAIRPPFTLETATAKVRAAEDAWNSRDPQRVSLAYSEDSEWRNRDQFLQGRRQIQEFLT
GKWERELDYRLTKALWSFTGNRIAVRFQYEYHDAAGQWFRAYGNELWEFDDDGLMRRREA
SINEVPIQELERKFHWPAPGPRPADDAGIPDVK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]