dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|283779995|ref|YP_003370750.1| (Pirellula staleyi DSM 6068)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Psta_2219 [Pirellula staleyi DSM 6068]
Sequence length 377
Sequence
MVRCKKLAPSWFSVSLIRMAGLAAVPWLLGLTAVSAQEKQPPAAPAVAAEKPAKTAAEDA
EILAMTRNYAAAYTQNDAKLVASYWAEKGVYIDPETGTSIEGREKIEAAFAKNFASEKGT
SLQVAVQSIRGISPDVAEVAGIAVVSVPGGVSSESSFVAMLVKQAGGWKIDSVRESETAV
PVSNYERLADLEWMVGEWKEEAGETKIFTRCRWIANRNFLLRSFTVMQGEEVQLAGTQII
GYDASIGTMRSWVFDTDGGFGEGVWAATKGESGEAKWTVKMSGVLQDGRRAAATQVITKI
DKDKATFQTVGREVDGELLPSSPAVTVVRVASSDVDANSSLGDVAVPTASSADSAAPSDN
PRDKNEAPAPQQPAESK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]