dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|268680676|ref|YP_003305107.1| (Sulfurospirillum deleyianum DSM 6946)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment formate dehydrogenase family accessory protein FdhD [Sulfurospirillum deleyianum DSM 6946]
Sequence length 262
Sequence
MEPVFKTTITKIKGKEKFEREDTLVREIKLELIVNGNRVGAVMATPVDQEALAIGYLMSE
NIIEKLSDVTSLKLLNDGMRVEIEAKVNEESIHKLNAEGVVISGCGKSMTANIDPEAIAA
KVIQSPFKLSSRKLSTEMSQFYTECPLYEQTGCVHTAKLFTDEHTYFIGEDIAQHNTIDK
VVGKAVLAGADVKNAFLMVSGRLSSEMVAKAVMHQIPILASRTASTCLGLMIAEKFGLTL
IGFVRGDTMNIYRHPQRIVVEA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]