dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|292655984|ref|YP_003535881.1| (Haloferax volcanii DS2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment aminopeptidase [Haloferax volcanii DS2]
Sequence length 444
Sequence
MDDLSPAVREAFARTWVDDRPWAFLTDLTAIGDRMAGGPGDRRASTLVADAFTDAGVRRV
EFDPFEMARWTRGDTTLDLTAPDERRFEAVALPYAPPATVSGPLVDVGYGTPSEIDAADV
DGALVVASTTTPAGGRFVHRMEKFNYAIGAGAVGFVFVNHVPGQLPPTGALRYDEEAAAP
AVGVSAETGSWLTDYAARGGEATLAVGAETTPGESRNVEGRVGPDTDRELLLCAHFDAHD
IAEGALDNGCGIAVVVTAARLLAEMDLALGVRVVGVGAEELGLTGSEHLADRLDLDRVAA
VVNVDGAGRFRDLVAHSHTSEATAAVATRVGNETRHPVDIEPEPHPFSDQWPFVRAGVPA
LQLRSESGERGRGWGHTHADTRDKVDDRNVREHGMLTALIVRELAATAADGEIPRLDDEL
AAAFRDADFETGMKAAGIWPDGWE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]