dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|294495023|ref|YP_003541516.1| (Methanohalophilus mahii DSM 5219)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment binding-protein-dependent transporters inner membrane component [Methanohalophilus mahii DSM 5219]
Sequence length 276
Sequence
MIVPQLPLGSVVEAAVYWISDTFGFALDAFSGVFKFFIDIFKDVLMAMPPLLFVVLLAVL
AYVIGRKDWKLALGTALGFIVILSMDLWEYSMETIALVISSAALALIIGIPLGILAAKSE
TLYRILRPILDLMQTMPSFVYLIPAVIFFGLGNVPGMIATVVFSMPPAIRLTTLGITQVP
TELVEVADAFGSTSWQKLIKVEIPVALKTIMAGVNQCIMLALSMVVIASMIGARGLGYQV
LIGIQRVDIGLGFEAGLGIVIIAIVLDRLTQHLTPK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]