dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|294495631|ref|YP_003542124.1| (Methanohalophilus mahii DSM 5219)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment carbamoyl-phosphate synthase small subunit [Methanohalophilus mahii DSM 5219]
Sequence length 365
Sequence
MMSAVIGLEDGTIVTGTGFGAEGTVCGELVFTTQYTGYEEALSDPSYKGQILMFTYPLIG
NYGVSDECFESDGVKAEGLVVREACPDPFHHSSKRTIYKLMEDEGKPGIAGVDTRMLTLN
NREHGTMRAALINGSDDGEAAVQLAREQPKISDIDLISKVTCKEAYTVKSKVNTADKKHV
VLIDLGMKAHIMDSLLARGMDVTVVPASTPAPAISDYEPDLLFLSNGPGDPQNAMDATKA
VNYFASELPIAGICLGHQVISRAMGADTYKLKFGHRGANQPVKDLSSSIVHITSQNHGFA
VDNDSLEATDLYTTELNTNDNTIEGVSHRDLDILSVQYHPDAHPGPMDTEKRFFDRIYKM
TGGDK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]