dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|294496623|ref|YP_003543116.1| (Methanohalophilus mahii DSM 5219)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment histidine biosynthesis protein [Methanohalophilus mahii DSM 5219]
Sequence length 235
Sequence
MFRIVFVLDIYNGIAVHARGGDRKKYQAVHLSSQVCETSSPCGIIETLNPREVYIADLNI
LQGEGEDKENIGELESLSSRSDVMLDAGVGRQEDADKWLRIANTLVLGTETASMDVIRNL
AARYPGRISVSIDRKNGKLLSKSSDIPENPDQAIEIFNELPLKDIIYLDLDRVGTSSGMD
IEMLSRIAKISYHPLLLGGGVRDMADIAELEKAGISGALVATAVHKQVIPVEQLR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]