dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|292491584|ref|YP_003527023.1| (Nitrosococcus halophilus Nc4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment TIR protein [Nitrosococcus halophilus Nc 4]
Sequence length 246
Sequence
MPDRIKIFVSYSHQDADYLEENSLLGFLKGLEKENIEFWTDQSIRPGELWDEVIKTQIQD
SHIALVLVSQGFLDSDYCQNTEIKHFLAHKAHLFPVILSPCDWRRHEWLKSRQFLPGGDQ
TVEEHFQDNGRRKRLFLQIREQLRERAELIRQSHYNGPSPPPPPGPFPGPFPGKVKIAFC
DRLGDDWKRLADCLEIRVSDQARFERGDEGRGIWVWLENRSRLSQLPAALREIKRGELAE
LLENFS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]