dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|284929243|ref|YP_003421765.1| (cyanobacterium UCYN-A)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment anti-anti-sigma regulatory factor [cyanobacterium UCYN-A]
Sequence length 119
Sequence
MIGNHLIYFGTAVFEPNGYITSNNVSDFQKELNSFIKNNSCKKFLVDMEQVEFIDSTGLI
AMVSACRLAQSFNKKLSVCSLSPSVRIIFELTQLDQALEIYNDRQSYIYETSNNETLTI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]