dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|284929508|ref|YP_003422030.1| (cyanobacterium UCYN-A)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment uroporphyrinogen-III synthase /uroporphyrinogen-III C-methyltransferase [cyanobacterium UCYN-A]
Sequence length 504
Sequence
MTGKIFFVGSGVFNISYLTLRGYYLLSNAEVVIYDTLIDSSLLELVPVNCLKIYVGKRRG
KLSTHQKYINNLLVNHCLLGKKIVRLKGGDPSLFGRLTEEVYALTQANCKYEIIPGISSA
LAAPVLAGIPITDKKISQCFTILTGHDLTILDWETLARSNTLIILMGIKNLSKIIDKLII
NGKSSNESVAIVHNCGSSNQITITGTLKTIVDKIAANYLSPAIIIIGEVVKLRNMPSSSN
LPLAGKKVIITRSHESSSQFKFQLQEAGADVITLPLLEILPPSSWERLDGAIQEISSFDW
LVLTSANGVKFFMERLHDLGKDIRILNNIKIAVVGKKTADYLKKFYLKPNFIPSDFIADS
LVENFPEDINGKKILFPRVETGGRDILLKEFIKKGASITEVPAYQSICPKNIDNEIWKIL
KNEQVDIITFTSSKIVKHFYHLFKNIFPDSIEEKKILSKLDNVYLACIGPQTSKTCNDLF
GRVDVEAKEYTLEGLTNQLIDYFS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]