dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|471263241|ref|YP_007646096.1| (Bdellovibrio exovorus JSS)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment enoyl-CoA hydratase/isomerase family protein [Bdellovibrio exovorus JSS]
Sequence length 254
Sequence
MKFIKVESPQPDIKVVSLNRPEVKNAFHPEMIAEITNFFQQESQTKTSKLLILKGEGTAF
CAGADLNWMKSMVNYSYEENIEDSKKLWGMFAAVQNCEVPVVAVAHGAVFGGALGLLACA
DYVYADEATQFCFSEVKLGLAPAVITGFITRKIPDAFCRPLMISGEVFNANEARRIGLVH
QTFTGTTVDVTEIVKTFAGNGTEAMREAKKLLNVLLETNSFDEAQAHCTRVIAERRISAE
GQEKLQKFLNRTSK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]