dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|289579795|ref|YP_003478261.1| (Natrialba magadii ATCC 43099)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment family 1 extracellular solute-binding protein [Natrialba magadii ATCC 43099]
Sequence length 403
Sequence
MGVLNVTMTNRRAILKTAGVLGTGCLAGCLGGDSDGESIRPVAIEEWPPESYNNELNTWN
WYAEWNEWGTEAFAEEYDLDSYSTETYASPGDWFTNLQSNPENHGIDQIGAFSEWQYRAV
EEDLLEPIPIDMMPNVEIPDQYLDVHREQFWSDDGAGGLYGIPHSIVISPIVMYNTEELQ
DPGESIDILWDEEFADEISMIAHQPAILCEAGALYTGQDPTDPDDFEEIQEVLEQQRDLV
FTYADDHQTQMQLVMSGDATLGSHMDGRAFRAIYNHGGDVDWFIPEEGATWGTDTLVIPK
NAPNPVTSTMYLDYLFSDEGMEQLIDTSLYRPPVANDEFTDGELGEIIRENWTDEWEKEG
DAEDFIDDLVLTEETMDNLYHNWPRSDEVIERYDEIWTAVTAG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]