dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|357410321|ref|YP_004922057.1| (Streptomyces flavogriseus ATCC 33331)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase S8 and S53 subtilisin kexin sedolisin [Streptomyces flavogriseus ATCC 33331]
Sequence length 1216
Sequence
MLPAAGPATAAPEPSATRDRPVPDVRAHAITLVTGDVVHWTDGVGGQDTVTVDRPEGATG
GVHVRQAGEDLYVIPDEASALLAAEKLDRRLFNISTLVEMGYDDRRSGGVPLIATYAAGT
GRSQPTAPRGSTKVRTLESVHGVALKAGKDDARAFWNDITRTRKSRSLDGGIAKLWLDGK
VEAALKDSVPQVNAPQAWAEGFDGKGTTVAVLDTGIDATHPDVKDRVKQSRSFVPGEEVV
DGNGHGTHVASTIAGSGAASDGANKGVAPAADLIVGKVLSNEGSGADSGIIEAMEWAKAE
GADVVSMSLGSSIPDDGGDPMAQAVDALSADGGPLFVIAAGNAYGAGTIGSPGSAASALT
VAAVDKQDRRADFSSMGPLVRSYGLKPDLSAPGVDINAAASQSVPGIDGMYQSMSGTSMA
TPHVAGAAAVLKQRHPEWSGQRIKDALMSSSKLLPDHTPYEQGTGRLDVKAAVDTTIEAT
GSVEVASYDWPHSAQDAVAERTLTYRNTGDEDVTLKLATDTDAAAYTLSTPELTVPAGST
AAAVLSIDPSRIANDTRFSGQVLATDPSGATVAHTGFAVNKERELHDLTLRLRDRAGEPM
DGTVVLAALGDTELGLVQVSGETTLRLPPGNYTAWTSADVDGDRSDSKAVAFLSAPETIL
DKATTVTLDASKARRVSVRTPQETETRQLRYDMARTSPEGVVQRDAYQIPLTYDQLWASP
TKKVTQGDFSFLTRWRQGEELIDLTADGHDVPVTVQSGSSVAEDSEQKLTGVFAGNGAAA
DYQGRAVKGKAVVVTRSDTVPPAERLANALAAGAKALFVVNDARGVAMESYAPYGEETTI
PVASVRKGAGGTLIEAARHGRKLSVDQRKFASYVYDLVDRHDGTVPDRSLAFAPSARQLA
KVENTFYGHKATLGGGYRYDIPDYGPGIGFEEYEKFPGTRTEWVTPLPGDSFWYENHSVL
NADASDTAHEMRSAELDHTAGRTYRADWFAPVTGPRLGTAYWGPFRTAGNDVQFNITPWT
DSGEGHSGSMPADEYDTTSFAFHQGDTLLKKGAGRAGYVWDLPAGKLPYRLVIDSERDAA
TWKTSTRTHTEWNFLSGALPDGTERADIPLLQLDYEVDTDLAGDVRAGRTIEVGLASGTQ
AWLDGAVKATRASLSVSYDEGASWSAAELRKGSAGRWTAKLRTPAKGASSVSLRAHTEGP
GGLAVDQEIIKAFGLK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]