dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSAPMP00000018744 (Apis mellifera 38.2d)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel group:AMEL2.0:GroupUn:230354685:230355214:-1 gene:ENSAPMG00000016854 transcript:ENSAPMT00000018741
Sequence length 176
Sequence
MRKFNKQKLIDSMTGALKLRSQINDVIDPLFKGITNICWLGIGGTYASGMQANIHMKEKS
GLETFYQNAAEYNVTGNKRITDKTLVVISSVTGNTKEMVDAVKNLNQVGAIILGFMDDPH
AKLASMLTYCISYPENEQLKFFMVGDRLMYLNGEFPDYDEFYQEMDQHFAKDIADI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]