dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Afu5g13040 (Aspergillus fumigatus Af293)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | Aspergillus fumigatus translation initiation factor eif-2b deltasubunit (557 aa)
Sequence length 556
Sequence
MATPINPPVPSSTSESATTAPAQQQSTSEMQPQQQQPPREPKGAAKNASKPAKQSQNPKE
GTPAADGASPADAGSQKLTPAELKKKAKAEKAARRAKERAEREQAGGAAPAQGANPPFAK
KGQTGAGGGGGAGGKDAAAAQSQKGRGYLPRRGSAQAAAGGAEQKKKQEDKNVAVFGHLY
GQQRRTTVAGAGKEVHPAVLALGLQMRDYVICGSSARCVATLLAFKRVIESYTTPLGTSL
ARHLTTHLSHQITYLSTCRPLSISQGNAIRALKLAISSIDPSVPEASAKASLSDFIDSFI
REKITVADQVIADSAAQKIQDGDVIVTYAGSSIVKQTLLTAHKQGKKFRVSIIDSRPLFE
GKNLARTLAKAGLEVQYSLVNGISHAIKDATKVFLGAHAMTSNGRLYSRVGTALVAMSAK
ERAGGVEVPVIVCCETVKFTDRVALDSIVVNEIADADELVMNEPLQQVTGLPDAAAVAQP
EPKKGNKSAANATPSESTVVTPGTSPLKDWKDTPNLQLLNIMYDVTPAEYVDMVVTEMGS
LPPSAVPIVHRMSTNM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]