dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Afu8g04070 (Aspergillus fumigatus Af293)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | Aspergillus fumigatus glucosamine-6-phosphate deaminase, putative (417 aa)
Sequence length 416
Sequence
MPNATAESFVKSEERLILISRNLIWLVFCHFPIRISLSDQVYYDAHQGQLFRLPPLFVTR
VIIRENAQQASEYIADYIISRIKAFKPTQDRPFVLGLPTGSSPEIIYRTLVQRHRTGEIS
FQNVVTFNMDEYVGLPRDHPESYHSFMYKHFFSHVDIPPQNINILDGNAPDLAAECASYE
ARIAGYGGIELFLGGVGADGHIAFNEPGSSLSSRTRVKTLAYDTILANSRFFDNDVDKVP
RMALTVGIQTIMEAREVVIVATGAHKALALKKGLEGGVNHMWTLSALQLHQHPLVVCDRD
ATLELKVKTVRYFESIEQSGTDARTQGPPLVYRPRTYVPAPLGAGKLPHQLTPASTPSKV
PKDLRINTEFQNSIEEDELTPDSMSSRLVDSAIGGLDTTLKADIMFDRMGARVVSH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]