dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|118431715|ref|NP_148358.2| (Aeropyrum pernix K1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment homoserine kinase [Aeropyrum pernix K1]
Sequence length 313
Sequence
MACSRARARAYSSAANLGPGFDALAVALDAYYDEVEVRVCSGGNSVYVDEVEGKFSSGVL
QGPNTAAEAVRGLLNMEGVEAEVGIRVYKGVPPGRGLGSSGASAAAAVAAVSHALALEVP
VDRLVFYAGLGERAAAGQPHFDNAAASILGGLAVVASDAAGKLRVFRVPFKAWFAVVTPM
NPVPQGKTGVMRKVLPENVSFRDAVRNFSRAAGIVAAAVNGDLKSMGALMMSDEIVEPRR
RSYVPCYTQVRKAALQAGALGFSLSGAGPSMIALAPSSEAAREIAAAMEESCICCDNPMT
VAAEPAPGASVVG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]