dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|294155536|ref|YP_003559920.1| (Mycoplasma crocodyli MP145)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PTS system, N-acetylglucosamine-specific, IICBA component [Mycoplasma crocodyli MP145]
Sequence length 569
Sequence
MNTATTQTSSFNHYFRKAMEKLGRVGKALMFPIAVLPIAAILLRIEADIPNDTAFSAAIG
FMIVNAGGIVFDNLPILFAIGLAFGFTKDSRGEAAFAGFIAMVLLTALLSNKGLPHLIYK
NLDLGAKEADGKNAEGIMQYTYGFKALFGSKYNAVMASNVLNGIVVGSLTAFIYNRIHSV
DMPKLLAFFAGRRLVPAYTILAVMIFGVLWAIVFPWIAYLIYLISDALYKGASSGFVARA
GIMGAYGFINRLLIPFGLHHIPNNLFWFQLGEFPTGKFDDKGVALLAHGDIFVFLNGVAK
NNPGGIFQAGFFPTMMFGLPAMVGAFYLTAQGKEQKTRVLAMYGSAALVSFLSGITEPIE
FAFMFVSPLLYFIHALLTGIFAFITGLFGIQIGFGFSAGFMDYVLSFPKSQAIIRESDVF
INSPLRAVFANPLWILPIGAVCAGVYFTITFFMIKGLNLNTPGRGTNLIELAEDNADDVQ
LSSNSNMSTKAKLIVLGYGGWENIEEFANCSTRLRYIVKDGSKVNEALLKKAGAMGVVRL
SDKSIQTIVGVEAETINGEIVDNKGTELK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]