dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|85057590|ref|YP_456506.1| (Aster yellows witches'-broom phytoplasma AYWB)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cysteine desulfhydrase [Aster yellows witches'-broom phytoplasma AYWB]
Sequence length 406
Sequence
MQNNPFRCLFPIFKTNPKLVYFDNAATSLKPQKVIDELTRFYNTNGLNTKSFGVLTNQNT
LLINETRIKTANFINAKPEEIIFTKGTTDSLNILSQNLGETLQEGDEIITSELEHNSSVL
PWIKQAKLKKAKLIFVPLNEQNQITVENFAKVLTSKTKIVVLTHVSNLLGYETPIKEITT
LAHQKNILVILDAAQSSSHLPIDVKFLDVDFLAFSSHKLYGPFGIGILFGKNHLLEQLQP
TLFGGVSIKEFSLKHFLLNEVPNKFESGTPNISGILAFKKALEFVEEIGFENIQKHEKKI
YQNIMKELKQIPNITIYNPQNFSNIITFNFNQIHAHDAEVFLSQENIYVRTGRCCAFLAT
QKIKQTSIIRVSIGIHNNQEDVGILIKNLKKTQTFFSKFNINKSRH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]