dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

BDET_02446 (Batrachochytrium dendrobatidis JEL423 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | BDEG_02439 | Batrachochytrium dendrobatidis hypothetical protein (467 aa)
Sequence length 466
Sequence
MQAAVEQFYSAGHSSRVLNHGMDQVDNFEDKNQQFIDLQNNAPLLPTASSVAVALDEPQR
LRNNVQRPVEFITLSCLHNECDIQADSTPTLTALFTTPFQWGFKFFWAILSYTRKIVDVG
LFQFLGLGVSGRRRTVGGSGMQRNRSSTERSTAECASVRFKEDFESQYGSKHPPFFVGTY
TQALNTAKSEIRYALVILQSDEHDDTDKFSRETISSDTFISFVSEKNLLVWGGNIHDAEA
FKVSAVLNATSYPFMALITLQGSRMAVAHRFEGLMSTGRIISKLRRLIDRFDPLLAGARA
DRASHAAARSIRQQQDDAYQASLLADQEKARKAKEEEEQAKKALLEQEQQRIAGLTKLER
RKQLKIELAANMPVEPDVGEPNTTRLSIRLPSGERVIRRFKADDTIQILWNFIETHDLKP
LDLETEFSIVCPFPRRVYRNMDMTMEQAGLVPSASVVVEEMFDDGL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]