dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|296127814|ref|YP_003635066.1| (Brachyspira murdochii DSM 12563)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Holliday junction resolvase YqgF [Brachyspira murdochii DSM 12563]
Sequence length 141
Sequence
MVLGVDFGRKKTGTAFMDMNIKIPFPLLLIEESNAKKVKRALMDIIEEKNIDTVVFGLPL
SDEGKESEWCSEIRRFSDFLLKSVKVNVVFVDEYGTSKEADYILRGRKKNVKKKANDLIA
AALILENYLNVLNMNNKNDNV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]