dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|302877880|ref|YP_003846444.1| (Gallionella capsiferriformans ES-2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment diguanylate cyclase with PAS/PAC sensor and hemerythrin-like metal-binding domain [Gallionella capsiferriformans ES-2]
Sequence length 491
Sequence
MNLMNESIEVFPWNDNFSTGIPLIDEQHKRLIHLINLLACGLAYQSDTAELDRIFSELAD
YAVYHFKTEEAVWHAHLADDEWEVEHQHSHNRFVTDLLELKSKKENATVNETLKDILSFL
THWLAFHILESDKHMSKVALGLQAGMTLTDAKLQASADMSGSMKVLIETVLSMYDTLSSR
TLELIKEVIDRQKAEAKLRLAANAIENTLEAICITDHCANIIDANPAFQQITQQPLDALI
GKNLRLLKSGLDDDLVFANIMEKLAEEGHWSGEIKSRSNSGETYTDWLTLSTIKEENGAI
CNYVGIFSNFSRLSGQWQELQHMANHDALTGLPNRLLLADRMELAMAHAERTGSFLAVCY
LDLDNFKPVNDTLGHTAGDLVLREISKRLQSHLRLNDTVSRVGGDEFVILLNDLHKPDDF
EELLVRILQEICLPIGIREQNVFVTGSIGVTQFPHDKGEAAMLLAHADSAMYQAKNLGKS
RYQLYDITKEN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]