dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|302880011|ref|YP_003848575.1| (Gallionella capsiferriformans ES-2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Galf_2818 [Gallionella capsiferriformans ES-2]
Sequence length 197
Sequence
MNHLDLGCGTNPQNPYKRANLFGLDIRDDAEQVLALRGISMKKANLVFEAIPFSDNYFSS
ISAIDFLEHIPRQICLGSSNELVYPFINIMNEVWRVLTPGGKFLAVTPAYPSSLAFADPT
HVNYLAQGTHEYFCGEHPAGRIYGFHGRFVARIAKLSAPTNYRDMPHSPFASAIRDLGRR
ISRNGLHHMVWELEAIK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]