dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|300311338|ref|YP_003775430.1| (Herbaspirillum seropedicae SmR1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment chemotaxis-specific methylesterase [Herbaspirillum seropedicae SmR1]
Sequence length 359
Sequence
MKIKVLIVDDSALIRSVMREIIGSQPDMEVVGVAPDPIIARELIKQTNPDVLTLDVEMPR
MDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAIDFVTKPKISIQSGMQEYAD
MIADKIRAAAKARVRARPARSAEQAAGGGSEALPQIRNPLTSSEKLIIIGASTGGTEAIK
EFLIRMPSDCPGILITQHMPEGFTRSFAQRLNNLCKISVVESAGNERVLPGHAYIAPGHS
HLKLVRSGANYMTQLDQGPPVNRHRPSVDVLFQSAATCAGKNAVGVILTGMGKDGAQGML
EMRNAGAYNFAQDEASCVVFGMPREAIAVGAAHEVLALQAMPGRVLAWLAEHGSRALRV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]