dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|296242977|ref|YP_003650464.1| (Thermosphaera aggregans DSM 11486)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment DNA primase [Thermosphaera aggregans DSM 11486]
Sequence length 416
Sequence
MSKYLIRAKIEIDGVVEKHDIVGAIFGQTEGLLGDQFDLRQLQDKGRIGRIQVNTKIQGS
KTIGEILIPSNLDRVETALLAALIESVDKVGPYDASLKVVDIVDLRLEKIKKIMERAEEI
LRKWSKEKAPDVREIIKNIQEMLKAPEPISYGPDELPAGPDVEKADTIILVEGRADVINL
LRYGINNVVAIGGARKVPETVKKLAETKKIMLFVDGDHGGDLILKEVLRNLKVDFVARAP
AGREVEELTGREIEEALSKATSVFDYLNNLVKQGSKEAQHLLQIQQKLHKLPVEAKPAEV
KEEAPQPPPQPVEKEETLVIPGKLAEDAKALIGTLEAILYDQNWNTLKKIPVRDLVNELA
SVQPGSVHGILLDGILTQRLINTAAEKNVKILVGARLGKVEEKPRDIVLLTFNELS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]