dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|296138829|ref|YP_003646072.1| (Tsukamurella paurometabola DSM 20162)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase S1 and S6 chymotrypsin/Hap [Tsukamurella paurometabola DSM 20162]
Sequence length 519
Sequence
MRRLVIILIGTALLALAGGPPAGAIIGGKVAPEAPPSLGSLQVELPGDAVTPDNHRCGTT
LIAPQWVVTASHCAILGNAGDAATGPMRASVRIGSTNTGTGGELVGVDRFYRLGTPTEAR
EDGYDWLLRDIALLRLERPVRATPIPIASKTPAAGTPARIMGWGSTCSDPAKMRDPQCYP
SELRTAETAVQDARACPNIQGSDTPRPLCIGGKDGRPTIGNADSGSPALVQENGAWVIAG
VVSGPGTNDDKGPGLYMDLTQQRDWIDSIINNTIVPDAPPTPDVAGAVLLGNCIGSIVRP
PGATPDAPAMVLTNGHCVSGDRPAPGGATVNQPSNRTMLAAGRTGESVTTVRADRLVYAT
MSRTDVAVYRLDSTYAQVAARGATVFDLATTPIRPGDRFSMNTGAARKSCSAEAVVPTVR
EGDWEQRDSVRYRDCSSVPGESGSPLISPDGRTVVGVNNSSNTDGEKCTDDNPCEIAADG
TVTAVKGRSYGQQIDALARCLTRDSIDLSRPGCDLPGAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]