dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|300022501|ref|YP_003755112.1| (Hyphomicrobium denitrificans ATCC 51888)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment class III aminotransferase [Hyphomicrobium denitrificans ATCC 51888]
Sequence length 461
Sequence
MSNRLQTAQIQELDSQHHLHPFTTHQTLRAGPGPRVIVKGEGAYVIDSEGNRILDGMAGL
WTTNIGYGNKELAQAAYDQILELPFYNTFFKTTHPPVVELSRKLAELAPAHLNQVFFGSS
GSESNDTAIRLIRHYWVLKGQPKRRIIISRKNAYHGSTIAAGSMGGMTHVHQHSYPVYEG
FRHVMDPYWYGDSFAGESPEDFGLRAARAIEEEILRCGPDNVAAFAGEPVQGAGGVKIAP
DSYWPEVQRIVDKYGILLLADEVITGFGRLGTWFGSEYYGIRPDLITFAKAATSGYVPLS
GVLVGDNIVDALMAENDDFNHGYTFSGHPVACAVALKNLEIMERDRLVPRVKETTGPALA
RMLERFKDHPLVGEVRSIGMMGAIELVADKKTRRRFTDPGRVGLICRDHFFRDGFIMRAV
FDTMVCAPPLIWTDAEFEKAGAVIESALNKTLQDVKGELTA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]