dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|344205365|ref|YP_004790507.1| (Mycoplasma putrefaciens KS1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ribonucleoside-diphosphate reductase subunit alpha [Mycoplasma putrefaciens KS1]
Sequence length 719
Sequence
MKDSKELILDDSNDEYIKLNARSKIFAKGQDNFKLDVQAAKSYITNHIEPRLMQFDDLKQ
RIDYLVANEYYDKQILDKYQFEEITELDDYAKSFNHSFPSFMGALKFFNAYALKTFDGEK
YLETYTDRALMNALFLGNGSYQKAKNILKNIMLGRFQPATPTFLNAGKKHRGEYVSCYLL
RTEDNMESICRTISTSLQLSKRGGGVAVCLTNLRETGSPIKNIDGLSSGPIPVMKILEDS
FTYADQLGQRQGAGAVYISAHHPDIISFLDTKRENADEKIRIKSLSLGVVIPDITFELAR
ENKEMALFSPYDVQKVYGVALSDISITEKYYEMLENPNIKKTFISARKLFLTIAELHFES
GYPYLLFEDTVNRRNAHDKKGRIIMSNLCSEIVQVSTPSQYNQDLSFTKIGEDICCNLGS
LNIDKMMKAGKEFEEAVDISITALDVVSRNSDLDCAPSIKFGNANNHAVGLGAMNLHGFL
ATNAIMYDSPEAVDFTNIFFYTLAYNAFKASNRLAKEFGKFNSFDESRFADGSWFEKYTK
CQADKWTPATKKVEELFKHYQVEIPTQTQWIELVEEIKKTGLANSHLMAVAPTGSISYLS
SCTPSLQPVVSTVEVRKEGKLGRVYVPAYQINFDNMGYYAVGAYEMGPDPIINIAAAAQQ
HVDQAISLTLFMTDKATTRDLNRAYINAFKQGCASIYYVRIRQDVLEDSENYECDACKI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]