dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|403514780|ref|YP_006655600.1| (Lactobacillus helveticus R0052)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Kinase domain protein [Lactobacillus helveticus R0052]
Sequence length 671
Sequence
MIDKGYLLGERYRIIDTLGEGGMANVYLAEDIILQRKVAVKILRLDLQNEPQTQARFKRE
ALATSELSHPNIVSVLDVGTDHGLHYMVMEYVDGPDLKEYIRQNAPLDLHEVIRIMDKIL
SAVALAHKHNVIHRDLKPQNILMDKRGNIKIADFGIAVALNQSSVTQTNSVMGSVHYMSP
EQTRGGLVTKQSDIYSLGIILYELITGTVPFNGDTPVSIALKHAQEPIPSIRKKDHSVPQ
ALENVVLKATAKDPRDRYATAQAMQADLDSSLDPERADEPVFVPNHGNNNDKTIVLPGFK
APEKEQPTESDEETKPDKKEKKKDFWQNVKSHKWWWIFSIIATGLIIFIMIFALSGSNNK
PHQVHIPDVTNITEKSAEKKLEAAGLQIGKVVKRQSDDIKKGHVIGTKPAAGNSMDQGKA
IILIVSSGSSMVKVPNVVGDNYYEAAEKLENQGFDVVREDQYSNKVARDNIISQSIAAGV
EVKPTQTTITLVVSRGKQVKPKINTVTLKDLHNYSLKSAQDYAKEHGLTLQINQEYSDEV
EKGLVISMQPKAGTKVERGSTVTIKVSRGPKEEKDTTITKTFTVNYIGTDLNKDDKSDSK
SGDASNKEDSSKGDHVQIYIKDDDHSLSNIYRDLYIKRDMSFSIPFSLKNGNGQLRVVRN
RETVLNEKVTK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]