dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|452206188|ref|YP_007486310.1| (Natronomonas moolapensis 8.8.11)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phosphoribosylaminoimidazole-succinocarboxamide synthase [Natronomonas moolapensis 8.8.11]
Sequence length 340
Sequence
MTSVKGFRIEEAATADSLGTGAFVFTDDYSVFDWGKMPDAIPNKGASLCAMGAANFERLE
AEGIATHYRGVVSGGGAVTGLDSVATPPREMAIELTRVPDLPHEGREYDYTAYHDAAGEN
YLIPLEIVFRNTVPVGSSLRSRADPGDFGLEYDAWPDGPVDLPEPVVEFSTKYEESDRYL
SRENADYVAGAADVDALESIARDVNRIITETAAAAGLKHEDGKIECLYYDGEIRVADVVG
TFDENRFSYAGQQLSKEVLRQYHKRTQPEWVEAVAEAKSEAKAEDVADWRELCGVDPEPL
PAHVVDAAREMYTAGTNAYLGRDLFDAPALEDAVAAIESF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]